NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207901_1033799

Scaffold Ga0207901_1033799


Overview

Basic Information
Taxon OID3300025045 Open in IMG/M
Scaffold IDGa0207901_1033799 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-46 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)691
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)49.9991Long. (o)-144.9989Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003905Metagenome / Metatranscriptome462Y
F004114Metagenome / Metatranscriptome452Y

Sequences

Protein IDFamilyRBSSequence
Ga0207901_10337991F004114GGAMSGIIGSKINIRGSGRIAKLGTDGQVLTSAGAGVAANYEDVAGGISWQAVETGS
Ga0207901_10337992F003905N/AITNLVSNTGVVATDVTGVGTARLYLAATEYGGDKGIFGYGNVTLSMTNLVSNAGVVGTDVTGVGTGRNSLAACSYGGDKGIFGYGTTGSSVSLTNLVSNAGVVATDTTGVGTAREGIMACEYGANQGIFGFGESGSGNLTGVTNLVSNTGVVASDVAAVGTARRYGAACSWG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.