NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208302_103143

Scaffold Ga0208302_103143


Overview

Basic Information
Taxon OID3300025028 Open in IMG/M
Scaffold IDGa0208302_103143 Open in IMG/M
Source Dataset NameMarine viral communities from Cariaco Basin, Caribbean Sea - 29_WHOI_OMZ (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1665
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameCaribbean Sea: Cariaco Basin
CoordinatesLat. (o)10.847Long. (o)-65.114Alt. (m)Depth (m)143
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037762Metagenome / Metatranscriptome167N
F101007Metagenome102N

Sequences

Protein IDFamilyRBSSequence
Ga0208302_1031432F037762AGAAGGVSNWKNFERRVATRLRGKRIPITGRKGLDIDHPILDIECKYRKQLPAWLFKDAWRQANEGTGIPVIAVGEYNSSDIFTIISIDTLVKLLETEYNRCQ
Ga0208302_1031433F101007GGAGMSMIVRHPFRNFFSSPFDVDWNEAYKQAMIPEDGAVIVQREWVEKKYRVKHESDGTVKYIPFTEEVVSESD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.