Scaffold Ga0209618_1001544

Overview

Basic Information

• Taxon OID: 3300025001
• Scaffold ID: Ga0209618_1001544
• Source Dataset Name: Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4634
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (12.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Glomerales → Glomeraceae → Rhizophagus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location

• Location Name: Rifle, Colorado, USA
• Coordinates
  • Lat. (^o): 39.53
  • Long. (^o): -107.78

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097007	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209618_10015446	F097007	N/A	MFAYVRKLDYNADNYGQLYFKHFSSYQFFEVIGIDRHVGFFNIGNNKYILDRERM