Scaffold Ga0210008_1003881

Overview

Basic Information

• Taxon OID: 3300024993
• Scaffold ID: Ga0210008_1003881
• Source Dataset Name: Groundwater microbial communities from aquifer - Crystal Geyser CG05_land_8/20/14_0.10 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 939
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location

• Location Name: USA: Utah: Grand County
• Coordinates
  • Lat. (^o): 38.9383
  • Long. (^o): -110.1342

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028669	Metagenome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210008_10038812	F028669	AGGAGG	MYARREIKKQRFKCWSDQFITNVNNGDGERGGRTLLRIGVMGKGRRAIEKIERGKNCVKR