Scaffold Ga0208888_107792

Overview

Basic Information

• Taxon OID: 3300024965
• Scaffold ID: Ga0208888_107792
• Source Dataset Name: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 115_HOW13 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2106
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Source Dataset Sampling Location

• Location Name: USA: Lake Washington, Seattle, Washington
• Coordinates
  • Lat. (^o): 48.3807
  • Long. (^o): -122.1599

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034611	Metagenome / Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208888_1077925	F034611	N/A	MQQLNSILSLTTDLLAYGGFNHLKDDQVSNLHHLILRLKEPLTRVQENLLLTFWHNADAGILPPALVYRCNTVLQQRGLCPIGELYVEMEME