NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255281_1019985

Scaffold Ga0255281_1019985


Overview

Basic Information
Taxon OID3300024855 Open in IMG/M
Scaffold IDGa0255281_1019985 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1356
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000645Metagenome / Metatranscriptome962Y
F005585Metagenome / Metatranscriptome395Y

Sequences

Protein IDFamilyRBSSequence
Ga0255281_10199852F005585AGGGGGMATRGTIFYAFTKSQSCSVFSSETQLTWRLSLSRPNSAEWWKVQSAKIRISISLDTPLSWVDADFLRQKIGTTLSLTRNHNQHQWCDYCKMRWGQMKDGTWHHKAQVPAIWKVQSETPTRRMQVRFYCQPCANEAQNWPDGTFWSLKEQLEAAIDDFAGREQLDVKLS
Ga0255281_10199853F000645GGAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHVLEESLTPNCDVYIVKTELYRTEADAAAWTTGLSSESKQKQYALELAETGSLGRALNLAGYFAKPNQTPKKPIQTTKPALAEFVKEQRPNDPEPIVWDVSAIAEELGAEVIDEIPICNHGPMILKQGSKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.