NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255236_1050166

Scaffold Ga0255236_1050166


Overview

Basic Information
Taxon OID3300024563 Open in IMG/M
Scaffold IDGa0255236_1050166 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)976
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059776Metagenome / Metatranscriptome133N
F063488Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
Ga0255236_10501663F059776AGGMLADLAVITLTVLIVGLFMLGAYRTGYREGHGDGYLRGRNIAKALKEVNK
Ga0255236_10501664F063488GAGGMSFLGGYEDVNARIKRARTEYPGLRLVAYIEDIDLKNGYILIRAEAYKNYEDDKPSAVDY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.