NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256306_1067891

Scaffold Ga0256306_1067891


Overview

Basic Information
Taxon OID3300024560 Open in IMG/M
Scaffold IDGa0256306_1067891 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)852
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010081Metagenome / Metatranscriptome308Y
F013524Metagenome / Metatranscriptome270Y
F042296Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0256306_10678911F010081N/AMKEQIDSIIKKHCLKMQEVDNTKSIPMVVKELDGIVYTMYRELYGLRDIRTDNYYLNSFTAD
Ga0256306_10678913F042296N/AMNLFKSIIKWTGVIVYAAFLATVAYAATMPEPIKLYVIYTYKFNERVIEKIYIKKENAQKYCDAFKDSHNYTFEELTISE
Ga0256306_10678914F013524N/ARLKEFTSNNCNTTLDPKLCEDIRYLCDEVERFSREIVKANDHMDEDFITIQRYKKKLSNYEPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.