NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256306_1021441

Scaffold Ga0256306_1021441


Overview

Basic Information
Taxon OID3300024560 Open in IMG/M
Scaffold IDGa0256306_1021441 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1611
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005293Metagenome / Metatranscriptome405Y
F006181Metagenome / Metatranscriptome379Y
F019468Metagenome / Metatranscriptome229N

Sequences

Protein IDFamilyRBSSequence
Ga0256306_10214412F019468N/AMTIEKTYKLSIKDTAYFLTEEEVTKLYEQCRKALNIDNANPYFPNYPPGVRKFDDDKTTPLNPTTPSIPYPYDTYPWYTPTYPSGPNYPYWTSPNTTTTCGTINAGEGICVKDTNWQPNLCNTVKSSTDINFLSDDMAVHEDNQKWRSSVQQALDKLSAKTNVTTSDGTTIR
Ga0256306_10214413F006181N/AMKNIVHVIYPDEAVHSFVMETDMVVSDILERVFAEWNHGSGMESELFIRSKKRSLSVNDIVCVNGKYYLCESFGWNEVTPQFVNELEEEVSNHPNRIQGAWFALNDVMWDRKSKNNLELV
Ga0256306_10214414F005293N/APTRDDLIGYISDTYKEINGFRPRPVWSELTYEQLDKWGRELAAEVVTYRKQEVVRNRIARGLRRAQQRAWVEKKRSYFTGSSFTIGNVVNF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.