NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256347_1002110

Scaffold Ga0256347_1002110


Overview

Basic Information
Taxon OID3300024545 Open in IMG/M
Scaffold IDGa0256347_1002110 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4458
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (22.22%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003038Metagenome / Metatranscriptome511Y
F065559Metagenome / Metatranscriptome127Y
F067648Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0256347_10021103F003038N/AMALSTTDLGTGGSGLPKTITPGNHVLKINSIELEEFKFIDGAYHLMMHVETQPIEGFEGFMIDKDDESKGRYAGQIGRVKASQYAFADGETKSGIKIQRDRSILIFLRTLAHTMGLDSWFLEQDGQHETIEDFVKAFNKTADFRGKFLEFCVAGKEYEGKTGYTNYDMWLPKAEGKKYAFGAIEAGAVIPYDETKHLKKLEVKEVKSFGDDDDVFHKPKTSSDFSLD
Ga0256347_10021106F065559N/AMNEINMMATLVKLADLGVTGIKVQYEGSGDSGAIENVIYTTEKVDPDEEAAFDDINDIYVWGQDVSHLEELDSGLSSDIANFVEEQLLNDIEDWWNNDGGSGAVCILVPSGKYKIYNDIRITHIESYFHEGSLIQKTL
Ga0256347_10021108F067648N/AMTRDELKNLINMFQSSDYENHVVAFHAIENSPLDNNELVLLYKFSGQPFAQWKKEIPMTAQRIADVIGDEAIALSSARVLGIITNNKAAKHVIETFLEFFIRDLTSMLGSIGYPMDKVDINVKIKDDGQSTES
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.