Basic Information | |
---|---|
Taxon OID | 3300024521 Open in IMG/M |
Scaffold ID | Ga0255056_10027353 Open in IMG/M |
Source Dataset Name | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Restricted |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2110 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Northwest Territories | |||||||
Coordinates | Lat. (o) | 70.66 | Long. (o) | -123.0 | Alt. (m) | Depth (m) | 570 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011880 | Metagenome / Metatranscriptome | 286 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0255056_100273532 | F011880 | AGAAGG | MGTAKSTHYTPRFRPFDMLAVPNQPLVILENTNHRIGAESVTGVQDSFHRYVDSDMIYFQFCGNTTVETEFGVYEMEPADVMLVPGGISHRSIGKNESLRYFCQTYEPVDYIMGEDKYTSRTSFEVKRIGGPQWPAAQDTETASKGNVVEKMHYWDDGPNDLTVVERDYDSLVGVAGLGRGKPGSGIKKLRAFDHFTAIVGKGGGDAGTQALMETASMRIRCYNMQDEQFAFHRALRSEEVRIQFRGDALDLSEFENIEVSPGEITIIPLGISHSVITIPPDDPNFLRLNFYSKLHWRVPVDPTRHVFNSRFEVSTTVHKEAEWRKQAAAGR |
⦗Top⦘ |