| Basic Information | |
|---|---|
| Taxon OID | 3300024517 Open in IMG/M |
| Scaffold ID | Ga0255049_10001216 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 14431 |
| Total Scaffold Genes | 24 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (37.50%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: British Columbia | |||||||
| Coordinates | Lat. (o) | 50.0528611 | Long. (o) | -123.8211389 | Alt. (m) | Depth (m) | 425 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007652 | Metagenome / Metatranscriptome | 347 | Y |
| F066601 | Metagenome | 126 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255049_1000121614 | F007652 | AGCAG | MNEIKYPSVRTYYICFDDDRTEVKSYGWVEPNQVFETIWIFDEFTDEAQWIAELLQWGIVPEIDEQGNLVL |
| Ga0255049_1000121617 | F066601 | GGA | MDRQLLISLFKSVWPYLVTFLLGVLVAWQGCGTGATTITETIEIEKPIYRTEYVDRWKTDTVRFVERITVTDTVTNTIIQEREVLIIDTVQIIEAWLTEVNRYDTTITLADGNLQATWFNYQNITEEAAFTYTSNVQKAPSYGIGLHASIEVQTDFIENVTPLFGVGLHGDIRKMYITANYKFNGDHFVGVTVGRKLWQR |
| ⦗Top⦘ |