Scaffold Ga0209980_10199082

Overview

Basic Information

• Taxon OID: 3300024516
• Scaffold ID: Ga0209980_10199082
• Source Dataset Name: Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 925
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → environmental samples → uncultured Woeseiaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Pacific Ocean: Mariana Trench
• Coordinates
  • Lat. (^o): 12.6311
  • Long. (^o): 144.7214
  • Depth (m): 6844

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099318	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209980_101990823	F099318	N/A	MIVQLDSKTRIVGTVHAWELQRQRNYKGGTKWEPYKWFTTFRSALEEAVHREIRTHPAASLSEAIEAVSGLVQR