NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255181_1025253

Scaffold Ga0255181_1025253


Overview

Basic Information
Taxon OID3300024502 Open in IMG/M
Scaffold IDGa0255181_1025253 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1129
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000847Metagenome / Metatranscriptome861N
F001129Metagenome / Metatranscriptome768Y
F032581Metagenome / Metatranscriptome179N

Sequences

Protein IDFamilyRBSSequence
Ga0255181_10252531F032581N/AMVRRTSEESSQMSMDEITRLTDKVKNDAEWYSERITRYLMEQRANYPLFNSPPSALDTIYPNGTNYNTGMALDARTLRRGAGLDRPWPYGYDPYCNNC
Ga0255181_10252532F000847N/AMSWIKIKQALLALANAHPQVNSFGTGDPLAIGTDNTINLRTPSRERIVYPLVFADVQSASTDLGSLALTVGVYFSDRVESIAAMGGVVSGSPTLGWQDNEDEVLSDQLQIAQDFISSLTNDPTQEWTLSTSVSLTRFVESRDDRTAGWVATMSFQLPYGHNICEIPT
Ga0255181_10252533F001129N/AMLGQGGSMRFVDAAVSGQNFDFIVVNTAATFTTLTGSGGEDLLTAYAMSGKSVSAGIVISGRNGGKITAVTPSVG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.