| Basic Information | |
|---|---|
| Taxon OID | 3300024486 Open in IMG/M |
| Scaffold ID | Ga0255059_10570664 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1766 RNA GHGlow gp2 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 531 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | New Zealand: Palmerston North, Manawatu-Wanganui | |||||||
| Coordinates | Lat. (o) | -40.3794 | Long. (o) | 175.6106 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005942 | Metagenome / Metatranscriptome | 385 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255059_105706641 | F005942 | N/A | IKFPKLDWSSKAEELENAPPELSEEIYKVLKEDLDAITKKKSINPHEIQNGLRDINFHKEYPDIYKIIDDMCLEYDLQGKEMTSDQILNFITEKMGDNKTRKGLNNIFDSLKDQKTGEITPEVLAKIAAEVGDELSEADLKKILQTISGPSSSININQDEFYYIMTKKPEDAFKINM |
| ⦗Top⦘ |