NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255059_10432975

Scaffold Ga0255059_10432975


Overview

Basic Information
Taxon OID3300024486 Open in IMG/M
Scaffold IDGa0255059_10432975 Open in IMG/M
Source Dataset NameMetatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1766 RNA GHGlow gp2 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)615
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameNew Zealand: Palmerston North, Manawatu-Wanganui
CoordinatesLat. (o)-40.3794Long. (o)175.6106Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005942Metagenome / Metatranscriptome385N

Sequences

Protein IDFamilyRBSSequence
Ga0255059_104329751F005942N/AMSTTAIKFPKLDWSENAEEYENSKPEISEEVYKLLKEDLDAITNKKAINPHEIQNGLKEINFHKEFPDIYKIIDDICLEYDLQGKEMTSEQILKYITDKLGDNKTRKGLNNIFDSLKDQKVGEITPEVLAKIAAEVGDELNEQDLKKILQTISGPSPSININQDEFYYIMTKKPEDAFKINM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.