Scaffold Ga0209986_10135692

Overview

Basic Information

• Taxon OID: 3300024433
• Scaffold ID: Ga0209986_10135692
• Source Dataset Name: Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1291
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: Black Sea
• Coordinates
  • Lat. (^o): 44.288
  • Long. (^o): 34.983
  • Depth (m): 2075

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024296	Metagenome	206	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209986_101356924	F024296	AGGAG	VTDDQLIEDLERAHKFRTYGGAGRTLQGDAAQRLRELTLYIEQLKSDKHWLNEQLLEIRTDLQLAEARLRERS