NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209986_10006098

Scaffold Ga0209986_10006098


Overview

Basic Information
Taxon OID3300024433 Open in IMG/M
Scaffold IDGa0209986_10006098 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9862
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameAtlantic Ocean: Black Sea
CoordinatesLat. (o)44.288Long. (o)34.983Alt. (m)Depth (m)2075
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086576Metagenome110Y
F091295Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0209986_1000609814F086576GGAGGMTEPKYPEDFKDWKTIYLMHDKRYLVIESPDGAMEACIHLEDNEVVGIRNKVTGEDIYDGNLSLAWKLGFKR
Ga0209986_100060986F091295AGGAGGVTNRSEYKETLGRLDKDTRVCIKYLEKLINDKFNAALVIQQPSPRINLSKIESNLDSLQKQIDGLRPKVDAAHSFVQEHDEQEKYLKKLTKNAETVLGEMKQHFEELYESGYYKEGTRRKIRDEGLIRKTTE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.