Basic Information | |
---|---|
Taxon OID | 3300024432 Open in IMG/M |
Scaffold ID | Ga0209977_10018055 Open in IMG/M |
Source Dataset Name | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3357 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | near North Sumatra | |||||||
Coordinates | Lat. (o) | 1.759 | Long. (o) | 96.774 | Alt. (m) | Depth (m) | 1855 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080857 | Metagenome / Metatranscriptome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209977_100180554 | F080857 | GAG | MSGNERVRETFLAKVYKGWRVTIYEPVREQLGLEIGDRVRVTIQKE |
⦗Top⦘ |