Scaffold Ga0209988_10086495

Overview

Basic Information

• Taxon OID: 3300024431
• Scaffold ID: Ga0209988_10086495
• Source Dataset Name: Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1921
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → environmental samples → uncultured Woeseiaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Kermadec Trench
• Coordinates
  • Lat. (^o): -32.8507
  • Long. (^o): -177.6629
  • Depth (m): 9177

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099318	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209988_100864952	F099318	N/A	MIIQLDSRTRIVGTNRAWELQRTRNYKGDKRWEAYKWFPSFRQALADAVHREIRVHPARTLADAIDGVADVVQKYEQLIPSEYRLSK