NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196962_10034801

Scaffold Ga0196962_10034801


Overview

Basic Information
Taxon OID3300024430 Open in IMG/M
Scaffold IDGa0196962_10034801 Open in IMG/M
Source Dataset NameSoil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1513
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.305Long. (o)-116.2547Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017620Metagenome / Metatranscriptome239Y
F019060Metagenome / Metatranscriptome232Y
F020315Metagenome / Metatranscriptome224Y

Sequences

Protein IDFamilyRBSSequence
Ga0196962_100348012F020315AGGAGGVDEKSLQLLKVMREQLGETTASRTVDAVAAASSLGMYPGTLDRSLLYLVRAGYLEESADHAMTSQGLYLITFQGIAAIDNA
Ga0196962_100348013F019060GGAGGMEEKREGRTKEMAEELSKLQQMHAHLAAVEQMAASYPENHSTRLVIESLELYRARTVVEGEIVALRGSLGYGTTGYGTL
Ga0196962_100348014F017620GGAGVDPTKAAHEAGLDVGDVGSDRYHHALGYLLEEGALVGDEHTETEAGPKQAHGYALYFFTRRAVKLLEG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.