Scaffold Ga0209991_10138915

Overview

Basic Information

• Taxon OID: 3300024429
• Scaffold ID: Ga0209991_10138915
• Source Dataset Name: Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1212
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: South Pacific Ocean
• Coordinates
  • Lat. (^o): -44.283
  • Long. (^o): -75.865
  • Depth (m): 3285

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028082	Metagenome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209991_101389152	F028082	GGAGG	MSPKQNPDDNITLNQLEGTQRSITNRLKLLQKKVRQNEREIIRELIQLTRENLYRKAQDICKDRDYYKEKIQAISKILEK