Scaffold Ga0190286_1056745

Overview

Basic Information

• Taxon OID: 3300024423
• Scaffold ID: Ga0190286_1056745
• Source Dataset Name: Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-3-4_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1058
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: Mexico: Guaymas Basin
• Coordinates
  • Lat. (^o): 27.0074
  • Long. (^o): -110.591
  • Depth (m): 2001

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015411	Metagenome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190286_10567454	F015411	GAG	MPRPGYGKKDGSRRGFREGGRGRNRTTKCRHPNKRAKR