Scaffold Ga0190286_1021357

Overview

Basic Information

• Taxon OID: 3300024423
• Scaffold ID: Ga0190286_1021357
• Source Dataset Name: Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-3-4_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1903
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: Mexico: Guaymas Basin
• Coordinates
  • Lat. (^o): 27.0074
  • Long. (^o): -110.591
  • Depth (m): 2001

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073072	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190286_10213575	F073072	GAGG	MKKVSKVVFIFARLINNPEAYEGKTNEDIEREILEEIAPIPYVARIEKVTVLDYRDC