| Basic Information | |
|---|---|
| Taxon OID | 3300024423 Open in IMG/M |
| Scaffold ID | Ga0190286_1004385 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-3-4_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4749 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 13 (92.86%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico: Guaymas Basin | |||||||
| Coordinates | Lat. (o) | 27.0074 | Long. (o) | -110.591 | Alt. (m) | Depth (m) | 2001 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102489 | Metagenome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0190286_10043855 | F102489 | GAG | MNNLGGVGNKMSSASRKGYRSQAEAAEEYIKRGWMVFVPQKSKYGAQDIFGMFDFVAISGDGSEIHFVQVKSNSTRGFLKKLKEWCENHKVKKVEWRLMVRLDARKFKRRWKVYR |
| ⦗Top⦘ |