NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190286_1000179

Scaffold Ga0190286_1000179


Overview

Basic Information
Taxon OID3300024423 Open in IMG/M
Scaffold IDGa0190286_1000179 Open in IMG/M
Source Dataset NameHydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-3-4_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)30773
Total Scaffold Genes40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (72.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameMexico: Guaymas Basin
CoordinatesLat. (o)27.0074Long. (o)-110.591Alt. (m)Depth (m)2001
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100148Metagenome102N

Sequences

Protein IDFamilyRBSSequence
Ga0190286_100017938F100148GGAMEKLEALSRGYSLEELMEYEELRGVALVKDLETDVQKIHSYSFAKFLADRNLAEIICVADTVQELMKNRRETARRVTQDRVYKMTTVIERLEKLLETNRSEKRRLLDRAKKIKIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.