Basic Information | |
---|---|
Taxon OID | 3300024348 Open in IMG/M |
Scaffold ID | Ga0244776_10612365 Open in IMG/M |
Source Dataset Name | 0.2um to 3um size fraction coassembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 685 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Columbia River Estuary, USA | |||||||
Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.9135 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031078 | Metagenome / Metatranscriptome | 183 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0244776_106123651 | F031078 | AGGAGG | MEAAIIAGLGLIAIPVVRAAIKSYRAKKSIADIAVDAVEAAVDVI |
⦗Top⦘ |