| Basic Information | |
|---|---|
| Taxon OID | 3300024348 Open in IMG/M |
| Scaffold ID | Ga0244776_10477951 Open in IMG/M |
| Source Dataset Name | 0.2um to 3um size fraction coassembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 810 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River Estuary, USA | |||||||
| Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.9135 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049624 | Metagenome / Metatranscriptome | 146 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0244776_104779512 | F049624 | AGG | MATIFPLSPTLNQTFTSNGITWRWDNYKWTLFTDAAVVFDHLHSYDGAVVSTGAAAGVSYDGGDANPA |
| ⦗Top⦘ |