Scaffold Ga0244775_10034387

Overview

Basic Information

• Taxon OID: 3300024346
• Scaffold ID: Ga0244775_10034387
• Source Dataset Name: Whole water sample coassembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4494
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Columbia River Estuary
• Coordinates
  • Lat. (^o): 46.234
  • Long. (^o): -123.9135

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001483	Metagenome / Metatranscriptome	686	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0244775_100343872	F001483	GAGG	VDKLKDFLLSLLTYIGESPFRLFTVVFLCILGFGGWVVYTEKDAFLASYRAQQAMPKMNGKYEEAYKFLLSQANADMVAILEVNTLSNTRKVAFLSTRDAGRERAHDGFNVGLFSKNYDNNNDVIGLMSGKIPCSPYLKPQSFIGFVYRDYGVSYMCRISVPAEPGVFIGQISVGWKEQPKDIEEVQTALAVASAILFDKK