Scaffold Ga0209992_10008768

Overview

Basic Information

• Taxon OID: 3300024344
• Scaffold ID: Ga0209992_10008768
• Source Dataset Name: Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6562
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (81.25%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Kolumbo volcano, Aegean Sea
• Coordinates
  • Lat. (^o): 36.5264
  • Long. (^o): 25.4868
  • Depth (m): 470

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061901	Metagenome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209992_100087687	F061901	AGG	MEMLIDFFKKIFGLDKLDYRIRRLERAKYWKEKYEKSKDAIRKARA