Scaffold Ga0255061_10739794

Overview

Basic Information

• Taxon OID: 3300024342
• Scaffold ID: Ga0255061_10739794
• Source Dataset Name: Metatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1742 RNA GHGhigh gp2 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 516
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: New Zealand: Palmerston North, Manawatu-Wanganui
• Coordinates
  • Lat. (^o): -40.3794
  • Long. (^o): 175.6106

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014346	Metagenome / Metatranscriptome	263	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255061_107397942	F014346	N/A	VVLEKTLESPLDCKEIQQVHSKGDQSWVFFARNDAKAETP