Basic Information | |
---|---|
Taxon OID | 3300024337 Open in IMG/M |
Scaffold ID | Ga0255060_10697217 Open in IMG/M |
Source Dataset Name | Metatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1728 RNA GHGlow gp2 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 516 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | New Zealand: Palmerston North, Manawatu-Wanganui | |||||||
Coordinates | Lat. (o) | -40.3794 | Long. (o) | 175.6106 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F062348 | Metagenome / Metatranscriptome | 130 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0255060_106972171 | F062348 | N/A | DKDSLNDSLSEYLSHKKNPETFNQNLKLTNQIIYFLNGLIPVITSDDEKNNKKVKTALDRLKISNKNIPNEEIGQLFIQKIKEFSNTKFGNSFVNMDWQVSVLDRKNDTSNLNKNEKVEITTKINNFNANEQKYESHVIKMDFNEFSEIMANFKKIDEQLHLFKN |
⦗Top⦘ |