Scaffold Ga0255060_10234598

Overview

Basic Information

• Taxon OID: 3300024337
• Scaffold ID: Ga0255060_10234598
• Source Dataset Name: Metatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1728 RNA GHGlow gp2 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 897
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: New Zealand: Palmerston North, Manawatu-Wanganui
• Coordinates
  • Lat. (^o): -40.3794
  • Long. (^o): 175.6106

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027710	Metagenome / Metatranscriptome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255060_102345981	F027710	AGGAG	LHPQKAMTKKKLYILVDRALKPVYGCVQGGHAVAQWMIEHPNSLEWSNDYLIYLYADVDKWKRRLEGYGIDYTEFKEPDLNYKTTALAVFGHEELFKNLKTVTED