Scaffold Ga0247687_1039409

Overview

Basic Information

• Taxon OID: 3300024286
• Scaffold ID: Ga0247687_1039409
• Source Dataset Name: Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 699
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location

• Location Name: USA: Indiana
• Coordinates
  • Lat. (^o): 40.4449
  • Long. (^o): -87.0297

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004141	Metagenome / Metatranscriptome	451	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247687_10394091	F004141	GGA	MTMISEAAMLSELAAEFPGYEFSTQRTWEGVSLIAVRQKGSARSGLYVVITPDLDEMRRTLLDNTGLDNT