Scaffold Ga0224564_1050647

Overview

Basic Information

• Taxon OID: 3300024271
• Scaffold ID: Ga0224564_1050647
• Source Dataset Name: Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 809
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.0448
  • Long. (^o): 13.618

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004710	Metagenome / Metatranscriptome	427	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224564_10506472	F004710	AGGAGG	MLYLVEGHPTIEVGDQVDAGEGPGPTIAKIIERFRPQAFYGNPTRRQTFMIVELNTPAEIAELMYVLSWWLKTEPTFTPIMPPEAYAEAIANAKKIISPQP