Basic Information | |
---|---|
Taxon OID | 3300024271 Open in IMG/M |
Scaffold ID | Ga0224564_1019319 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1227 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Czech Republic: South Bohemian Region | |||||||
Coordinates | Lat. (o) | 49.0448 | Long. (o) | 13.618 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001645 | Metagenome / Metatranscriptome | 658 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0224564_10193193 | F001645 | AGGAGG | MALLKAPSKQPKTTTLQVRLEEGVRNNLDKYAEFIDANASYVMSEALKLLFRKDDEFKHWLGQHLNDGNQEQTQGDALKKTA |
⦗Top⦘ |