NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228623_1095616

Scaffold Ga0228623_1095616


Overview

Basic Information
Taxon OID3300024267 Open in IMG/M
Scaffold IDGa0228623_1095616 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 28D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)536
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020254Metagenome / Metatranscriptome225Y
F021734Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
Ga0228623_10956161F020254AGGAGGMETLWTVAAPAWQWILGTAVALYVWEEYLEHVWYKFKHWVLNEPHKAK
Ga0228623_10956163F021734AGGAGMEVLAIIGLLAGVGYGMDNDWKVAKAYHSYENCRVDNPKVQNTMTSWQYDPCNLAAYH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.