NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209978_10009604

Scaffold Ga0209978_10009604


Overview

Basic Information
Taxon OID3300024263 Open in IMG/M
Scaffold IDGa0209978_10009604 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4584
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-27.74Long. (o)14.251Alt. (m)Depth (m)1133
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015693Metagenome252Y

Sequences

Protein IDFamilyRBSSequence
Ga0209978_100096042F015693AGGAGGMLYIIYFNLKNGVSEEEFVNNSKELSRYLKGKVEGLGPMKLYRHHNGANPRYYQMHMEMKDYGTWDRFFAFIEKNAKVAKLLQEWRKKLIDLNTHFDEFVIEIPL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.