Scaffold Ga0209978_10005432

Overview

Basic Information

• Taxon OID: 3300024263
• Scaffold ID: Ga0209978_10005432
• Source Dataset Name: Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5862
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -27.74
  • Long. (^o): 14.251
  • Depth (m): 1133

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008412	Metagenome / Metatranscriptome	333	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209978_100054321	F008412	AGGTGG	VPKISLYIRTRKQGQGCYIASVPLKKLTKLSEFRKKRWTFKDGWLILEAF