NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210003_1047503

Scaffold Ga0210003_1047503


Overview

Basic Information
Taxon OID3300024262 Open in IMG/M
Scaffold IDGa0210003_1047503 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2218
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)58.622Long. (o)18.254Alt. (m)Depth (m)437
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003404Metagenome489Y

Sequences

Protein IDFamilyRBSSequence
Ga0210003_10475033F003404AGGAGGMSLKALLRAGKELLKAKKPSATPTTGQQQRQITYEPKPSQAQAKELVTQELKNPPVVLKKTKPLQMGDDMAPAFGSSTYDWAMRMGRSKYTADEWLDHLTSTRKVNFKIFGKPATKTVREQKRFKYDSGPFAGKEVNVTKEELFDSNLAVFNEAGDLTGGLLYAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.