Scaffold Ga0210003_1044397

Overview

Basic Information

• Taxon OID: 3300024262
• Scaffold ID: Ga0210003_1044397
• Source Dataset Name: Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2326
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 58.622
  • Long. (^o): 18.254
  • Depth (m): 437

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084869	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0210003_10443977	F084869	AGG	MVVNKKDVDEHHQIIDVLTKKQQELVKETKNNILSERTFQALENLFNVIDVEVKPFNQSNMMKSAMENAYNIIQENKRKTNNR