NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210003_1007775

Scaffold Ga0210003_1007775


Overview

Basic Information
Taxon OID3300024262 Open in IMG/M
Scaffold IDGa0210003_1007775 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7790
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)58.622Long. (o)18.254Alt. (m)Depth (m)437
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006773Metagenome / Metatranscriptome365Y
F015360Metagenome / Metatranscriptome255Y
F019253Metagenome / Metatranscriptome231Y

Sequences

Protein IDFamilyRBSSequence
Ga0210003_100777510F015360GAGMDYLWAPKDEKLVSSLLDSLGFVKVGESQRYPTGVKYDALVAICDVISSQEKMASMVASRTHELQASRKTTGKAPSIDSVVAALANGKMSEADLKQAMKKAGLIK
Ga0210003_100777513F019253GGAGMNPVEKFNSYMTQHTDKVPLLSVQSIKDNRFTVLREFLSASFEDVEDNAWSVSQNLGKFIDALSTMEPEDVKKITNTVRKYEVKGESFGIRGERTYAYDRSRVDRALIRRKRAN
Ga0210003_10077759F006773N/AMNKVQTKTALPWKSGSEKEVDFYVEIGTTPYGKYGMYKEMIPVGTGSRGSHQAIADSVRLSNPDVFERYELRQIVSRG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.