Scaffold Ga0210003_1004497

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0210003_1004497

Scaffold Ga0210003_1004497

Overview

Basic Information
Taxon OID	3300024262 Open in IMG/M
Scaffold ID	Ga0210003_1004497 Open in IMG/M
Source Dataset Name	Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11015
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (23.81%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	58.622	Long. (^o)	18.254	Alt. (m)		Depth (m)	437
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017299	Metagenome / Metatranscriptome	241	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210003_100449714	F017299	GAG	MNNTYHKPLKITVEFYNKKISTEIDHSDLSLDELHDLWVDIVRAMGYAEETIKKLYDE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.