Scaffold Ga0247680_1000023

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247680_1000023

Scaffold Ga0247680_1000023

Overview

Basic Information
Taxon OID	3300024246 Open in IMG/M
Scaffold ID	Ga0247680_1000023 Open in IMG/M
Source Dataset Name	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	104400
Total Scaffold Genes	111 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	88 (79.28%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location Name	USA: Indiana
Coordinates	Lat. (^o)	40.4449	Long. (^o)	-87.0297	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010795	Metagenome / Metatranscriptome	299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247680_10000237	F010795	N/A	VQAVHVLRQQGIAVGFPMQTADGQIIFSVGKDTLTANQILDLLERGELHAEGLRKSVEAQASAKPLRKKAASP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.