Scaffold Ga0233392_1006012

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0233392_1006012

Scaffold Ga0233392_1006012

Overview

Basic Information
Taxon OID	3300024241 Open in IMG/M
Scaffold ID	Ga0233392_1006012 Open in IMG/M
Source Dataset Name	Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1063
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	USA: Colorado
Coordinates	Lat. (^o)	38.96	Long. (^o)	-106.99	Alt. (m)		Depth (m)	50
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020656	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233392_10060121	F020656	N/A	DVLIKNNLRPQKYRIHIRAKGFSSPTEPHALTISTADGSVSVTETSFPFRCLEEVDAFGSDAFASIVADRMTELIRQVRNTGRRL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.