Scaffold Ga0247724_1004394

Overview

Basic Information

• Taxon OID: 3300024239
• Scaffold ID: Ga0247724_1004394
• Source Dataset Name: Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2238
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Oklahoma
• Coordinates
  • Lat. (^o): 35.7
  • Long. (^o): -98.594
  • Depth (m): 3933

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015080	Metagenome / Metatranscriptome	257	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247724_10043943	F015080	N/A	MFDLLKFEPHNIPNAIAARYKFENGWEISVVAGPGLYGRIDEETYEVGIFRPNGNLTEDVSGWNTKHEVSAMMWVLSQL