Scaffold Ga0228665_1000045

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0228665_1000045

Scaffold Ga0228665_1000045

Overview

Basic Information
Taxon OID	3300024235 Open in IMG/M
Scaffold ID	Ga0228665_1000045 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Monterey Bay, California, United States - 79D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	21624
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	36.8313	Long. (^o)	-121.9047	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038192	Metagenome / Metatranscriptome	166	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0228665_100004515	F038192	N/A	EDLYAKCSAKDAGSRDMTVTLEVSNITTDNKITNVAFEFDGEPKWFKVKSGPTSIDTESSATYETEFDNKVIGTSKKKGLKPRRRTIGWRGKATNYKGLALIVKVTFADGSTDEVKLTTNLRKNRG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.