NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247664_1003625

Scaffold Ga0247664_1003625


Overview

Basic Information
Taxon OID3300024232 Open in IMG/M
Scaffold IDGa0247664_1003625 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3487
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007754Metagenome / Metatranscriptome345Y
F097628Metagenome104N

Sequences

Protein IDFamilyRBSSequence
Ga0247664_10036251F097628GGGGGMTDLTNRMRTCAAAILAQKDKGGLGEPWVTEMVAADAADLLIEASNMLEAVPADAVDLLTEARNMLETIPASLGEPMEIIPPVAPRPSIEFGLGSATWLAPGDTLPKANPYRSANTCPNCDSRANKTARREGSVIMLTCPACGHQW
Ga0247664_10036255F007754AGGAMRNYLTSIVVATALAAVLATPANAQVVLGGQTWTNTGTTLSLDATVPGGNQPLNIQCVICGDHQPQQDSTFGYTDFHNSGNLSDAIFFSTNVVGGGNPGVDTVGIGYDGSFLRAFLAAGGDPSLQFSIGIDVNDTGTPQTLEAFALLNLTQHTVLAQYSLLQPGGTLIPSQNNGTGFPDYTLSGFNINLGTDIQAGDQLIFYARISGANDGPDSFFLVPQQVPAPIAGAGIPGLIAACGGLVAFARRRKKQQEMGVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.