Scaffold Ga0228598_1029800

Overview

Basic Information

• Taxon OID: 3300024227
• Scaffold ID: Ga0228598_1029800
• Source Dataset Name: Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1074
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.0427
  • Long. (^o): 13.6161

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001552	Metagenome / Metatranscriptome	672	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228598_10298002	F001552	N/A	MRVVVTLIGPDGTMRRRMVDTATSSDTGPWEELLARALAALPPYRAVPGGAVYHLRVDDQVVLVAGQDLSGPLYDLVTAVLAIGEPPH