| Basic Information | |
|---|---|
| Taxon OID | 3300024227 Open in IMG/M |
| Scaffold ID | Ga0228598_1000485 Open in IMG/M |
| Source Dataset Name | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8167 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Czech Republic: South Bohemian Region | |||||||
| Coordinates | Lat. (o) | 49.0427 | Long. (o) | 13.6161 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000789 | Metagenome / Metatranscriptome | 891 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0228598_10004853 | F000789 | AGGAGG | MTDRRSFSEMKTEQARMAESWKAEGRLSEAWVIADPEIVEIFSAGVGFGIEVGRRTRTDPGYSPDEWRRALREAMEKAAALEAKLETANKGIMKD |
| ⦗Top⦘ |